PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929607.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 245aa    MW: 27732.4 Da    PI: 9.3616
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929607.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.14.6e-46141381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+e+d+ k++Pwd+     + ++e yfF  r+ ky++g+r+nra   gyWkatgkdk+++++
  XP_010929607.1  14 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SIIPEIDLGKYNPWDFSG---GCKQERYFFYLREAKYRNGHRSNRASGCGYWKATGKDKAIVAS 104
                     79****************************.89**************83...346799**********************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk+Lvfy+g+ p  ++tdW+mheyrl
  XP_010929607.1 105 sSNQVVGMKKVLVFYHGKPPGVSRTDWIMHEYRL 138
                     67788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-557173IPR003441NAC domain
PROSITE profilePS5100553.26514173IPR003441NAC domain
PfamPF023651.2E-2515138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDKPSFMRQG VLRLPPGFRF HPTDEELVVQ YLKRKVFSCP LPASIIPEID LGKYNPWDFS  60
GGCKQERYFF YLREAKYRNG HRSNRASGCG YWKATGKDKA IVASSSNQVV GMKKVLVFYH  120
GKPPGVSRTD WIMHEYRLAG TETRACVFPQ RKNSTHSSMV PTKDWVLCRI FKKKRANTMD  180
VDAEEYREEN QIRNGGIGFI DFMGLQHRDQ QPSLASSSES SCVTEPSDGS SSGDETSCSN  240
GRPLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-471217418169NAC domain-containing protein 19
3swm_B3e-471217418169NAC domain-containing protein 19
3swm_C3e-471217418169NAC domain-containing protein 19
3swm_D3e-471217418169NAC domain-containing protein 19
3swp_A3e-471217418169NAC domain-containing protein 19
3swp_B3e-471217418169NAC domain-containing protein 19
3swp_C3e-471217418169NAC domain-containing protein 19
3swp_D3e-471217418169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929607.10.0PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY937e-77NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB3TLL00.0B3TLL0_ELAGV; ANAC083 transcription factor
STRINGGSMUA_Achr10P11910_0011e-105(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63173254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-77NAC domain containing protein 83
Publications ? help Back to Top
  1. Low ET, et al.
    Oil palm (Elaeis guineensis Jacq.) tissue culture ESTs: identifying genes associated with callogenesis and embryogenesis.
    BMC Plant Biol., 2008. 8: p. 62
    [PMID:18507865]